PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa20g081120.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 826aa    MW: 91721.7 Da    PI: 5.2633
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa20g081120.2genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.81.2e-20111166156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t+ q++e+e+lF++n++p+ ++r++L+++lgL+ rqVk+WFqNrR+++k
  Csa20g081120.2 111 KKRYHRHTNRQIQEMEALFKENPHPDDKQRKRLSAELGLKPRQVKFWFQNRRTQMK 166
                     688999***********************************************998 PP

2START146.52.5e-463215541206
                     HHHHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEEEESSS...........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S CS
           START   1 elaeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv..........dsgealrasgvvdmvlallveellddkeqWdetla 77 
                     e+a ++ qel k+ +aeep+W k            +n++e+++ f+              +  ea++a  vv+m++ +lv  +l+   +W+e++ 
  Csa20g081120.2 321 EIAVSCVQELTKMCDAEEPLWIKKKsdkisgeiLCLNEEEYMRLFP---WpvenhnnkadFAREASKANSVVIMNSITLVDAFLNAD-KWSEMFC 411
                     578899***************9999777776554456666666664...033556699999**************************.******9 PP

                     ....EEEEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE..-TTS--..-TTSEE-EESSEEEEEEEEC CS
           START  78 ....kaetlevissg.....galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvd..seqkppe.sssvvRaellpSgiliepks 158
                         +a+t++ issg     g l lm+ae+q+lsplvp R+ +f+Ry +q  + g w+ivd  +d  ++q++p  + s    ++ pSg++i++++
  Csa20g081120.2 412 sivaRAKTVQIISSGvsgasGSLLLMYAEFQVLSPLVPtREAYFLRYVEQnAENGNWAIVDFPIDsfHDQMQPPsTNSPHEYKRKPSGCIIQDMP 506
                     9999**********************************************99*********99883334444444666667779*********** PP

                     TCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 159 nghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     ng+s+v wvehv+++++++h+ +   vksg+a+ga++w+  lqrqce+
  Csa20g081120.2 507 NGYSQVKWVEHVEVDEKHVHETFAEYVKSGMAFGANRWLDVLQRQCER 554
                     **********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.6E-20100169IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-21105175IPR009057Homeodomain-like
PROSITE profilePS5007117.589108168IPR001356Homeobox domain
SMARTSM003891.4E-18109172IPR001356Homeobox domain
CDDcd000863.88E-19111169No hitNo description
PfamPF000463.5E-18111166IPR001356Homeobox domain
PROSITE patternPS000270143166IPR017970Homeobox, conserved site
PROSITE profilePS5084843.887312557IPR002913START domain
SuperFamilySSF559611.03E-30314556No hitNo description
CDDcd088753.18E-107316553No hitNo description
SMARTSM002342.6E-26321554IPR002913START domain
PfamPF018529.6E-39322554IPR002913START domain
SuperFamilySSF559617.42E-15595801No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 826 aa     Download sequence    Send to blast
MLSIGEGNVM TSDNMRFASQ QPSSSSPGTI QNPNFNFIPF NSFSSIIPKE EHGMMSMMMM  60
MGDGTVEEMM ENGSAGGSFG SGSEQAEDPK FGNESDVNEL QDDEQPPPAK KKRYHRHTNR  120
QIQEMEALFK ENPHPDDKQR KRLSAELGLK PRQVKFWFQN RRTQMKAQQD RTENAMLRAE  180
NANLKSENCH LQGELRCLSC PSCGGPTVLG DIPFNELHIE NCRLREELDR ICCITSRYTG  240
RPMQSMPSSQ PLIDPSSTLP HHQPSLELDM SVYAGNFPEH SCADMMMLPS QDTTCFFPDQ  300
TVNNNNNNML LAEEEKVIAM EIAVSCVQEL TKMCDAEEPL WIKKKSDKIS GEILCLNEEE  360
YMRLFPWPVE NHNNKADFAR EASKANSVVI MNSITLVDAF LNADKWSEMF CSIVARAKTV  420
QIISSGVSGA SGSLLLMYAE FQVLSPLVPT REAYFLRYVE QNAENGNWAI VDFPIDSFHD  480
QMQPPSTNSP HEYKRKPSGC IIQDMPNGYS QVKWVEHVEV DEKHVHETFA EYVKSGMAFG  540
ANRWLDVLQR QCERIASLMA RNITDLGVIS SAEARRNMMR LSQRMVRTFC VNISTAYGQS  600
WTALSETSKD TVRITTRKMC EPGQPTGVLL SAVSTTWLPF THHQVFDLIR DQHHQSLLEV  660
LFNGNSPHEV AHIANGSHPG NCISLLRINV ASNSWHNVEL MLQESSIDNS GSLIVYSTVD  720
VDSIQLAMNG EDSSNIPILP LGFSIVPVNP PEGISVNSNS PPSCLLTVAI QVLASNVPTA  780
KPNLSTVTTI NNHLCATVNQ ITSALTSSVT PAIASSAAVS KQEAS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136141DKQRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0133940.0AB013394.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MQD22.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010494885.10.0PREDICTED: homeobox-leucine zipper protein HDG5-like isoform X1
RefseqXP_010494886.10.0PREDICTED: homeobox-leucine zipper protein HDG5-like isoform X2
RefseqXP_010494887.10.0PREDICTED: homeobox-leucine zipper protein HDG5-like isoform X2
RefseqXP_010494888.10.0PREDICTED: homeobox-leucine zipper protein HDG5-like isoform X2
RefseqXP_010494890.10.0PREDICTED: homeobox-leucine zipper protein HDG5-like isoform X3
RefseqXP_010494891.10.0PREDICTED: homeobox-leucine zipper protein HDG5-like isoform X4
SwissprotQ9FJS20.0HDG5_ARATH; Homeobox-leucine zipper protein HDG5
TrEMBLR0GUB60.0R0GUB6_9BRAS; Uncharacterized protein
STRINGAT5G46880.10.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7